Table 1.

FSH peptides used for anti–FSHR-IR construction

Construct nameaFSH-derived peptidesSequencePredicted affinityPredicted cross-reactivity
Anti-FSHR 33–53β-IRβ-Chain 33–53aaYTRDLVYKDPARPKIQKTCTF10−5 mol/LHuman/mouse
Anti-FSHR 51–65β-IRβ-Chain 51–65aaCTFKELVYETVRVPGC10−4 mol/LHuman
Anti-FSHR 81–95β-IRβ-Chain 81–95aaQCHCGKCDSDSTDCT10−5 mol/LHuman/mouse
Anti-FSHR antagonist A-IRβ-Chain (87–94aa) + α-chain (25–42aa)CDSDSTDCILQCMGCCFSRAYPTPLR10−8 mol/LHuman/mouse
Anti-FSHR agonist A-IRβ-Chain (87–94aa) + α-chain (25–42aa)CDSDSTDCILQCMGCCFSRAYPTPLRWCAGYCYCYTRD10−7 mol/LHuman/mouse
+b (27–45aa)VKDPARP
Anti-FSHR a+b-IRFSH (α-chain + β-chain)GenBank Gene IDs: 1081 (FSH, α subunit) + 2488 (FSH, β subunit)NAHuman/mouse
  • Abbreviation: NA, not available.

    aFinal chimeric IR constructs were engineered to encode for either an intracellular CD3z (-z) or a tandem CD3z and CD28 (-28z) domain.